PDB entry 1c7p

View 1c7p on RCSB PDB site
Description: crystal structure of mutant human lysozyme with four extra residues (eaea) at the n-terminal
Class: hydrolase
Keywords: extra n-terminal residues, hydrolase
Deposited on 2000-02-29, released 2000-04-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.197
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (Start-133)
      • engineered (1-3)
    Domains in SCOPe 2.06: d1c7pa_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c7pA (A:)
    eaeakvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygi
    fqinsrywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrc
    qnrdvrqyvqgcgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c7pA (A:)
    aeakvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygif
    qinsrywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcq
    nrdvrqyvqgcgv