PDB entry 1c7p

View 1c7p on RCSB PDB site
Description: crystal structure of mutant human lysozyme with four extra residues (eaea) at the n-terminal
Deposited on 2000-02-29, released 2000-04-05
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-21, with a file datestamp of 2000-06-21.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.197
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1c7pa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c7pA (A:)
  aeakvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygif
  qinsrywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcq
  nrdvrqyvqgcgv