PDB entry 1c7o

View 1c7o on RCSB PDB site
Description: crystal structure of cystalysin from treponema denticola contains a pyridoxal 5'-phosphate-l-aminoethoxyvinylglycine complex
Deposited on 2000-03-16, released 2000-07-26
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-26, with a file datestamp of 2000-07-26.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.193
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1c7oa_
  • Chain 'B':
    Domains in SCOP 1.55: d1c7ob_
  • Chain 'C':
    Domains in SCOP 1.55: d1c7oc_
  • Chain 'D':
    Domains in SCOP 1.55: d1c7od_
  • Chain 'E':
    Domains in SCOP 1.55: d1c7oe_
  • Chain 'F':
    Domains in SCOP 1.55: d1c7of_
  • Chain 'G':
    Domains in SCOP 1.55: d1c7og_
  • Chain 'H':
    Domains in SCOP 1.55: d1c7oh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7oA (A:)
    miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
    vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
    pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
    wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
    niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
    knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
    gdggigferinlaapssviqeslerlnkalkdlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7oB (B:)
    miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
    vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
    pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
    wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
    niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
    knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
    gdggigferinlaapssviqeslerlnkalkdlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7oC (C:)
    miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
    vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
    pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
    wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
    niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
    knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
    gdggigferinlaapssviqeslerlnkalkdlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7oD (D:)
    miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
    vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
    pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
    wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
    niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
    knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
    gdggigferinlaapssviqeslerlnkalkdlk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7oE (E:)
    miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
    vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
    pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
    wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
    niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
    knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
    gdggigferinlaapssviqeslerlnkalkdlk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7oF (F:)
    miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
    vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
    pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
    wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
    niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
    knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
    gdggigferinlaapssviqeslerlnkalkdlk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7oG (G:)
    miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
    vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
    pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
    wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
    niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
    knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
    gdggigferinlaapssviqeslerlnkalkdlk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7oH (H:)
    miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
    vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
    pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
    wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
    niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
    knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
    gdggigferinlaapssviqeslerlnkalkdlk