PDB entry 1c7n

View 1c7n on RCSB PDB site
Description: crystal structure of cystalysin from treponema denticola contains a pyridoxal 5'-phosphate cofactor
Class: transferase
Keywords: Transferase, Aminotransferase, Pyridoxal phosphate
Deposited on 2000-03-16, released 2000-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.208
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cystalysin
    Species: Treponema denticola [TaxId:158]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56257 (0-End)
      • conflict (87)
      • conflict (153)
      • conflict (266)
    Domains in SCOPe 2.07: d1c7na_
  • Chain 'B':
    Compound: cystalysin
    Species: Treponema denticola [TaxId:158]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56257 (0-End)
      • conflict (87)
      • conflict (153)
      • conflict (266)
    Domains in SCOPe 2.07: d1c7nb_
  • Chain 'C':
    Compound: cystalysin
    Species: Treponema denticola [TaxId:158]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56257 (0-End)
      • conflict (87)
      • conflict (153)
      • conflict (266)
    Domains in SCOPe 2.07: d1c7nc_
  • Chain 'D':
    Compound: cystalysin
    Species: Treponema denticola [TaxId:158]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56257 (0-End)
      • conflict (87)
      • conflict (153)
      • conflict (266)
    Domains in SCOPe 2.07: d1c7nd_
  • Chain 'E':
    Compound: cystalysin
    Species: Treponema denticola [TaxId:158]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56257 (0-End)
      • conflict (87)
      • conflict (153)
      • conflict (266)
    Domains in SCOPe 2.07: d1c7ne_
  • Chain 'F':
    Compound: cystalysin
    Species: Treponema denticola [TaxId:158]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56257 (0-End)
      • conflict (87)
      • conflict (153)
      • conflict (266)
    Domains in SCOPe 2.07: d1c7nf_
  • Chain 'G':
    Compound: cystalysin
    Species: Treponema denticola [TaxId:158]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56257 (0-End)
      • conflict (87)
      • conflict (153)
      • conflict (266)
    Domains in SCOPe 2.07: d1c7ng_
  • Chain 'H':
    Compound: cystalysin
    Species: Treponema denticola [TaxId:158]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56257 (0-End)
      • conflict (87)
      • conflict (153)
      • conflict (266)
    Domains in SCOPe 2.07: d1c7nh_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c7nA (A:)
    miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
    vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
    pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
    wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
    niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
    knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
    gdggigferinlaapssviqeslerlnkalkdlknrhlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c7nA (A:)
    miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
    vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
    pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
    wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
    niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
    knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
    gdggigferinlaapssviqeslerlnkalkdlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c7nB (B:)
    miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
    vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
    pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
    wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
    niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
    knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
    gdggigferinlaapssviqeslerlnkalkdlknrhlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c7nB (B:)
    miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
    vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
    pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
    wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
    niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
    knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
    gdggigferinlaapssviqeslerlnkalkdlk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1c7nC (C:)
    miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
    vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
    pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
    wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
    niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
    knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
    gdggigferinlaapssviqeslerlnkalkdlknrhlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c7nC (C:)
    miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
    vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
    pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
    wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
    niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
    knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
    gdggigferinlaapssviqeslerlnkalkdlk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1c7nD (D:)
    miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
    vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
    pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
    wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
    niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
    knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
    gdggigferinlaapssviqeslerlnkalkdlknrhlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c7nD (D:)
    miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
    vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
    pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
    wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
    niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
    knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
    gdggigferinlaapssviqeslerlnkalkdlk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1c7nE (E:)
    miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
    vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
    pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
    wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
    niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
    knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
    gdggigferinlaapssviqeslerlnkalkdlknrhlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c7nE (E:)
    miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
    vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
    pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
    wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
    niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
    knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
    gdggigferinlaapssviqeslerlnkalkdlk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1c7nF (F:)
    miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
    vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
    pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
    wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
    niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
    knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
    gdggigferinlaapssviqeslerlnkalkdlknrhlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c7nF (F:)
    miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
    vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
    pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
    wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
    niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
    knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
    gdggigferinlaapssviqeslerlnkalkdlk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1c7nG (G:)
    miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
    vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
    pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
    wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
    niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
    knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
    gdggigferinlaapssviqeslerlnkalkdlknrhlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c7nG (G:)
    miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
    vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
    pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
    wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
    niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
    knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
    gdggigferinlaapssviqeslerlnkalkdlk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1c7nH (H:)
    miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
    vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
    pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
    wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
    niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
    knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
    gdggigferinlaapssviqeslerlnkalkdlknrhlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c7nH (H:)
    miydfttkisrknlgslkwdlmysqnpevgnevvplsvadmefknppelieglkkyldet
    vlgytgpteeykktvkkwmkdrhqwdiqtdwiintagvvpavfnavreftkpgdgviiit
    pvyypffmaiknqerkiiecellekdgyytidfqkleklskdknnkallfcsphnpvgrv
    wkkdelqkikdivlksdlmlwsdeihfdlimpgyehtvfqsideqladktitftapsktf
    niagmgmsniiiknpdirerftksrdatsgmpfttlgykaceicykecgkwldgcikvid
    knqrivkdffevnhpeikapliegtylqwidfralkmdhkameefmihkaqiffdegyif
    gdggigferinlaapssviqeslerlnkalkdlk