PDB entry 1c7m

View 1c7m on RCSB PDB site
Description: solution structure of the functional domain of paracoccus denitrificans cytochrome c552 in the reduced state
Deposited on 2000-03-03, released 2000-07-19
The last revision prior to the SCOP 1.57 freeze date was dated 2000-07-19, with a file datestamp of 2000-07-19.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1c7ma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7mA (A:)
    madpaagekvfgkckachkldgndgvgphlngvvgrtvagvdgfnysdpmkahggdwtpe
    alqefltnpkavvkgtkmafaglpkiedranliaylegqq