PDB entry 1c7m

View 1c7m on RCSB PDB site
Description: solution structure of the functional domain of paracoccus denitrificans cytochrome c552 in the reduced state
Class: electron transport
Keywords: electron transport, cytochrome c552, heme, redox states, isotope enrichment {15n}, nmr spectroscopy, solution structure
Deposited on 2000-03-03, released 2000-07-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (cytochrome c552)
  Species: Paracoccus denitrificans [TaxId:266]
  Gene: CYCM
  Database cross-references and differences (RAF-indexed):
  • Uniprot P54820 (1-99)
    • see remark 999 (0)
  Domains in SCOPe 2.08: d1c7ma_
• Heterogens: HEC

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c7mA (A:)
  madpaagekvfgkckachkldgndgvgphlngvvgrtvagvdgfnysdpmkahggdwtpe
  alqefltnpkavvkgtkmafaglpkiedranliaylegqq