PDB entry 1c7k

View 1c7k on RCSB PDB site
Description: crystal structure of the zinc protease
Class: hydrolase
Keywords: alpha and beta protein, METALLOPROTEINASE, HYDROLASE
Deposited on 2000-02-19, released 2001-04-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: zinc endoprotease
    Species: Streptomyces caespitosus [TaxId:53502]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1c7ka_
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7kA (A:)
    tvtvtydpsnapsfqqeianaaqiwnssvrnvqlraggnadfsyyegndsrgsyaqtdgh
    grgyifldyqqnqqydstrvtahetghvlglpdhyqgpcselmsgggpgpsctnpypnaq
    ersrvnalwang