PDB entry 1c7j

View 1c7j on RCSB PDB site
Description: pnb esterase 56c8
Deposited on 2000-02-21, released 2000-03-29
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-29, with a file datestamp of 2000-03-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.214
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1c7ja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7jA (A:)
    thqivttqygkvkgttengvhkwkgipyakppvgqwrfkapeppevwedvldataygpvc
    pqpsdllslsytelprqsedclyvnvfapdtpsqnlpvmvwihggafylgagseplydgs
    klaaqgevivvtlnyrlgpfgfmhlssfdeaysdnlglldqaaalkwvrenisafggdpd
    nvtvfgesaggmsiaallampaakglfqkaimesgasrtmtkeqaastaaaflqvlgine
    sqldrlhtvaaedllkaadqlriaekenifqlffqpaldpktlpeepeksiaegaasgip
    lligttrdegylfftsdsdvrsqetldaaleyslgkplaekaadlyprslesqihmvtdl
    lfwrpavafasaqshyapvwmyrfdwhpekppynkafhalelpfvfgnldglermakaei
    tdevkqlshtiqsawitfaktgnpsteavnwpayheetretvildseitiendpesekrq
    klfps