PDB entry 1c7j

View 1c7j on RCSB PDB site
Description: pnb esterase 56c8
Class: hydrolase
Keywords: alpha-beta hydrolase, directed evolution, organic activity, pnb esterase
Deposited on 2000-02-21, released 2000-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.214
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (para-nitrobenzyl esterase)
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37967
      • engineered (59)
      • engineered (143)
      • engineered (316)
      • engineered (321)
      • engineered (333)
      • engineered (357)
      • engineered (369)
    Domains in SCOPe 2.07: d1c7ja_
  • Heterogens: SO4, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c7jA (A:)
    mthqivttqygkvkgttengvhkwkgipyakppvgqwrfkapeppevwedvldataygpv
    cpqpsdllslsytelprqsedclyvnvfapdtpsqnlpvmvwihggafylgagseplydg
    sklaaqgevivvtlnyrlgpfgfmhlssfdeaysdnlglldqaaalkwvrenisafggdp
    dnvtvfgesaggmsiaallampaakglfqkaimesgasrtmtkeqaastaaaflqvlgin
    esqldrlhtvaaedllkaadqlriaekenifqlffqpaldpktlpeepeksiaegaasgi
    plligttrdegylfftsdsdvrsqetldaaleyslgkplaekaadlyprslesqihmvtd
    llfwrpavafasaqshyapvwmyrfdwhpekppynkafhalelpfvfgnldglermakae
    itdevkqlshtiqsawitfaktgnpsteavnwpayheetretvildseitiendpesekr
    qklfpskge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c7jA (A:)
    thqivttqygkvkgttengvhkwkgipyakppvgqwrfkapeppevwedvldataygpvc
    pqpsdllslsytelprqsedclyvnvfapdtpsqnlpvmvwihggafylgagseplydgs
    klaaqgevivvtlnyrlgpfgfmhlssfdeaysdnlglldqaaalkwvrenisafggdpd
    nvtvfgesaggmsiaallampaakglfqkaimesgasrtmtkeqaastaaaflqvlgine
    sqldrlhtvaaedllkaadqlriaekenifqlffqpaldpktlpeepeksiaegaasgip
    lligttrdegylfftsdsdvrsqetldaaleyslgkplaekaadlyprslesqihmvtdl
    lfwrpavafasaqshyapvwmyrfdwhpekppynkafhalelpfvfgnldglermakaei
    tdevkqlshtiqsawitfaktgnpsteavnwpayheetretvildseitiendpesekrq
    klfps