PDB entry 1c7i

View 1c7i on RCSB PDB site
Description: thermophylic pnb esterase
Deposited on 2000-02-21, released 2000-03-29
The last revision prior to the SCOP 1.57 freeze date was dated 2000-03-29, with a file datestamp of 2000-03-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.203
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1c7ia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7iA (A:)
    thqivttqygkvkgttengvhkwkgipyakppvgqwrfkapeppevwedvldatvygpvc
    pqpsdllslsykelprqsedclyvnvfapdtpsqnlpvmvwihggafylgagseplydgs
    klaaqgevivvtlnyrlgpfgfmhlssfdeaysdnlglldqaaalkwvrenisafggdpd
    nvtvfgesaggmsiaallampaakglfqkaimesgasrtmtkeqaastaaaflqvlgine
    sqldrlhtvaaedllkaadqlriaekenifqlffqpaldpktlpeepeksiaegaasgip
    lligttrdegyffftpdsdvysqetldaaleyllgkplaekvadlyprslesqihmvtdl
    lfwrpavafasaqshyapvwmyrfdwhpekppynkafhtlelpfvfgnldelermakaei
    tdevkqlshtiqsawttfaktgnpsteavnwpayheesretvildseitiendpesekrq
    klf