PDB entry 1c7h

View 1c7h on RCSB PDB site
Description: crystal structure of a mutant r75a in ketosteroid isomerase from psedomonas putida biotype b
Class: isomerase
Keywords: ksi, r75a, isomerase
Deposited on 2000-02-19, released 2000-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.172
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: delta-5-3-ketosteroid isomerase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445
      • engineered (74)
    Domains in SCOPe 2.07: d1c7ha_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c7hA (A:)
    mnlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqg
    lgggkvracltgpvaashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayw
    sevnlsvrepq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c7hA (A:)
    nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
    kvracltgpvaashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywsevn
    lsv