PDB entry 1c7g

View 1c7g on RCSB PDB site
Description: tyrosine phenol-lyase from erwinia herbicola
Class: lyase
Keywords: lyase, tyrosine degradation, pyridoxal 5'-phosphate dependent
Deposited on 2000-02-18, released 2003-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.186
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine phenol-lyase
    Species: Pantoea agglomerans [TaxId:48984]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c7ga_
  • Chain 'B':
    Compound: tyrosine phenol-lyase
    Species: Pantoea agglomerans [TaxId:48984]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c7gb_
  • Chain 'C':
    Compound: tyrosine phenol-lyase
    Species: Pantoea agglomerans [TaxId:48984]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c7gc_
  • Chain 'D':
    Compound: tyrosine phenol-lyase
    Species: Pantoea agglomerans [TaxId:48984]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c7gd_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7gA (A:)
    mnypaepfriksvetvsmisrdervkkmqeagyntfllnskdiyidlltdsgtnamsdkq
    wagmmigdeayagsenfyhlektvkelfgfkhivpthqgrgaenllsqlaikpgqyvagn
    myftttrfhqekngatfvdivrdeahdaslnlpfkgdidlnklatlikekgaeniayicl
    avtvnlaggqpvsmanmravhemastygikifydatrcvenayfikeqeagyenvsikdi
    vhemfsyadgctmsgkkdclvniggflcmndeemfsaakelvvvyegmpsygglagrdme
    amaiglreamqyeyiehrvkqvrylgdklreagvpiveptgghavfldarrfcphltqdq
    fpaqslaasiymetgvrsmergivsagrsketgenhrpkletvrltiprrvytyahmdvv
    adgiiklyqhkedirgltfvyepkqlrfftarfdfi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7gB (B:)
    mnypaepfriksvetvsmisrdervkkmqeagyntfllnskdiyidlltdsgtnamsdkq
    wagmmigdeayagsenfyhlektvkelfgfkhivpthqgrgaenllsqlaikpgqyvagn
    myftttrfhqekngatfvdivrdeahdaslnlpfkgdidlnklatlikekgaeniayicl
    avtvnlaggqpvsmanmravhemastygikifydatrcvenayfikeqeagyenvsikdi
    vhemfsyadgctmsgkkdclvniggflcmndeemfsaakelvvvyegmpsygglagrdme
    amaiglreamqyeyiehrvkqvrylgdklreagvpiveptgghavfldarrfcphltqdq
    fpaqslaasiymetgvrsmergivsagrsketgenhrpkletvrltiprrvytyahmdvv
    adgiiklyqhkedirgltfvyepkqlrfftarfdfi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7gC (C:)
    mnypaepfriksvetvsmisrdervkkmqeagyntfllnskdiyidlltdsgtnamsdkq
    wagmmigdeayagsenfyhlektvkelfgfkhivpthqgrgaenllsqlaikpgqyvagn
    myftttrfhqekngatfvdivrdeahdaslnlpfkgdidlnklatlikekgaeniayicl
    avtvnlaggqpvsmanmravhemastygikifydatrcvenayfikeqeagyenvsikdi
    vhemfsyadgctmsgkkdclvniggflcmndeemfsaakelvvvyegmpsygglagrdme
    amaiglreamqyeyiehrvkqvrylgdklreagvpiveptgghavfldarrfcphltqdq
    fpaqslaasiymetgvrsmergivsagrsketgenhrpkletvrltiprrvytyahmdvv
    adgiiklyqhkedirgltfvyepkqlrfftarfdfi
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7gD (D:)
    mnypaepfriksvetvsmisrdervkkmqeagyntfllnskdiyidlltdsgtnamsdkq
    wagmmigdeayagsenfyhlektvkelfgfkhivpthqgrgaenllsqlaikpgqyvagn
    myftttrfhqekngatfvdivrdeahdaslnlpfkgdidlnklatlikekgaeniayicl
    avtvnlaggqpvsmanmravhemastygikifydatrcvenayfikeqeagyenvsikdi
    vhemfsyadgctmsgkkdclvniggflcmndeemfsaakelvvvyegmpsygglagrdme
    amaiglreamqyeyiehrvkqvrylgdklreagvpiveptgghavfldarrfcphltqdq
    fpaqslaasiymetgvrsmergivsagrsketgenhrpkletvrltiprrvytyahmdvv
    adgiiklyqhkedirgltfvyepkqlrfftarfdfi