PDB entry 1c7f

View 1c7f on RCSB PDB site
Description: d95e oxidized flavodoxin mutant from d. vulgaris
Class: electron transport
Keywords: electron transport, electron transfer, flavoprotein, fmn, flavodoxin, mutant
Deposited on 2000-02-11, released 2000-08-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Desulfovibrio vulgaris [TaxId:881]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00323 (0-146)
      • engineered (93)
    Domains in SCOPe 2.01: d1c7fa_
  • Chain 'B':
    Compound: flavodoxin
    Species: Desulfovibrio vulgaris [TaxId:881]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00323 (0-146)
      • engineered (93)
    Domains in SCOPe 2.01: d1c7fb_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7fA (A:)
    pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
    ddsielqddfiplfdsleetgaqgrkvacfgcgessyeyfcgavdaieeklknlgaeivq
    dglridgdpraarddivgwahdvrgai
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7fB (B:)
    pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
    ddsielqddfiplfdsleetgaqgrkvacfgcgessyeyfcgavdaieeklknlgaeivq
    dglridgdpraarddivgwahdvrgai