PDB entry 1c7e

View 1c7e on RCSB PDB site
Description: d95e hydroquinone flavodoxin mutant from d. vulgaris
Class: electron transport
Keywords: electron transport, electron transfer, flavoprotein, fmn, flavodoxin, mutant
Deposited on 2000-02-16, released 2000-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Desulfovibrio vulgaris [TaxId:881]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00323 (0-146)
      • engineered (93)
    Domains in SCOPe 2.07: d1c7ea_
  • Chain 'B':
    Compound: flavodoxin
    Species: Desulfovibrio vulgaris [TaxId:881]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00323 (0-146)
      • engineered (93)
    Domains in SCOPe 2.07: d1c7eb_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7eA (A:)
    pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
    ddsielqddfiplfdsleetgaqgrkvacfgcgessyeyfcgavdaieeklknlgaeivq
    dglridgdpraarddivgwahdvrgai
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7eB (B:)
    pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
    ddsielqddfiplfdsleetgaqgrkvacfgcgessyeyfcgavdaieeklknlgaeivq
    dglridgdpraarddivgwahdvrgai