PDB entry 1c7d

View 1c7d on RCSB PDB site
Description:
Deposited on 2000-02-09, released 2000-06-30
The last revision prior to the SCOP 1.65 freeze date was dated 2000-06-30, with a file datestamp of 2000-06-30.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.189
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1c7da1, d1c7da2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1c7db_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1c7dd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7dA (A:)
    mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
    kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
    vhasldkflasvstvltskyrggvlspadktnvkaawgkvgahageygaealermflsfp
    ttktyfphfdlshgsaqvkghgkkvadaltnavahvddmpnalsalsdlhahklrvdpvn
    fkllshcllvtlaahlpaeftpavhasldkflasvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7dB (B:)
    mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgkvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7dD (D:)
    mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgkvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh