PDB entry 1c7b

View 1c7b on RCSB PDB site
Description: deoxy rhb1.0 (recombinant hemoglobin)
Class: oxygen storage/transport
Keywords: heme, oxygen delivery vehicle, blood substitute, oxygen storage/transport complex
Deposited on 2000-02-09, released 2000-06-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.189
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (deoxyhemoglobin (alpha chain))
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69905 (0-140)
      • engineered (0)
    Domains in SCOPe 2.04: d1c7ba_
  • Chain 'B':
    Compound: protein (deoxyhemoglobin (beta chain))
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68871 (0-145)
      • engineered (0)
      • engineered (107)
    Domains in SCOPe 2.04: d1c7bb_
  • Chain 'C':
    Compound: protein (deoxyhemoglobin (alpha chain))
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69905 (0-140)
      • engineered (0)
    Domains in SCOPe 2.04: d1c7bc_
  • Chain 'D':
    Compound: protein (deoxyhemoglobin (beta chain))
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68871 (0-145)
      • engineered (0)
      • engineered (107)
    Domains in SCOPe 2.04: d1c7bd_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7bA (A:)
    mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
    kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
    vhasldkflasvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7bB (B:)
    mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgkvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7bC (C:)
    mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
    kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
    vhasldkflasvstvltskyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c7bD (D:)
    mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgkvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh