PDB entry 1c77

View 1c77 on RCSB PDB site
Description: staphylokinase (sak) dimer
Class: hydrolase
Keywords: beta-grasp family, hydrolase
Deposited on 2000-02-01, released 2000-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.198
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphylokinase
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c77a_
  • Chain 'B':
    Compound: staphylokinase
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c77b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c77A (A:)
    sssfdkgkykkgddasyfeptgpylmvnvtgvdgkgnellsphyvefpikpgttltkeki
    eyyvewaldataykefrvveldpsakievtyydknkkkeetksfpitekgfvvpdlsehi
    knpgfnlitkvviekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c77A (A:)
    gkykkgddasyfeptgpylmvnvtgvdgkgnellsphyvefpikpgttltkekieyyvew
    aldataykefrvveldpsakievtyydknkkkeetksfpitekgfvvpdlsehiknpgfn
    litkvviekk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c77B (B:)
    sssfdkgkykkgddasyfeptgpylmvnvtgvdgkgnellsphyvefpikpgttltkeki
    eyyvewaldataykefrvveldpsakievtyydknkkkeetksfpitekgfvvpdlsehi
    knpgfnlitkvviekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c77B (B:)
    ykkgddasyfeptgpylmvnvtgvdgkgnellsphyvefpikpgttltkekieyyvewal
    dataykefrvveldpsakievtyydknkkkeetksfpitekgfvvpdlsehiknpgfnli
    tkvviekk