PDB entry 1c76

View 1c76 on RCSB PDB site
Description: staphylokinase (sak) monomer
Class: hydrolase
Keywords: beta-grasp family, hydrolase
Deposited on 2000-02-01, released 2000-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.201
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphylokinase
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c76a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c76A (A:)
    sssfdkgkykkgddasyfeptgpylmvnvtgvdgkgnellsphyvefpikpgttltkeki
    eyyvewaldataykefrvveldpsakievtyydknkkkeetksfpitekgfvvpdlsehi
    knpgfnlitkvviekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c76A (A:)
    syfeptgpylmvnvtgvdgkgnellsphyvefpikpgttltkekieyyvewaldatayke
    frvveldpsakievtyydknkkkeetksfpitekgfvvpdlsehiknpgfnlitkvviek
    k