PDB entry 1c75

View 1c75 on RCSB PDB site
Description: 0.97 a "ab initio" crystal structure of cytochrome c-553 from bacillus pasteurii
Deposited on 2000-02-09, released 2000-03-22
The last revision prior to the SCOP 1.59 freeze date was dated 2001-02-14, with a file datestamp of 2001-02-14.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: 0.116
AEROSPACI score: 1.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1c75a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c75A (A:)
    vdaeavvqqkcischggdltgasapaidkaganyseeeildiilngqggmpggiakgaea
    eavaawlaekk