PDB entry 1c74

View 1c74 on RCSB PDB site
Description: Structure of the double mutant (K53,56M) of phospholipase A2
Class: hydrolase
Keywords: Alpha Helix, Beta Sheet, Double mutant, HYDROLASE
Deposited on 2000-01-22, released 2000-07-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.189
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Bos taurus [TaxId:9913]
    Gene: MATURE PLA2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00593 (0-122)
      • engineered (52)
      • engineered (55)
      • engineered (121)
    Domains in SCOPe 2.05: d1c74a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c74A (A:)
    alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncymqamklds
    ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldk
    knc