PDB entry 1c74

View 1c74 on RCSB PDB site
Description: Structure of the double mutant (K53,56M) of phospholipase A2
Deposited on 2000-01-22, released 2000-07-22
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-22, with a file datestamp of 2000-07-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.189
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1c74a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c74A (A:)
    alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncymqamklds
    ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldk
    knc