PDB entry 1c72

View 1c72 on RCSB PDB site
Description: tyr115, gln165 and trp209 contribute to the 1,2-epoxy-3-(p-nitrophenoxy)propane conjugating activities of glutathione s-transferase cgstm1-1
Class: transferase
Keywords: glutathione s-transferase, 1, 2-epoxy-3-(p-nitrophenoxy)propane, epoxidase activity, steady-state kinetics, x-ray crystallography
Deposited on 2000-02-02, released 2000-08-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.19
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glutathione s-transferase)
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1c72a1, d1c72a2
  • Chain 'B':
    Compound: protein (glutathione s-transferase)
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1c72b1, d1c72b2
  • Chain 'C':
    Compound: protein (glutathione s-transferase)
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1c72c1, d1c72c2
  • Chain 'D':
    Compound: protein (glutathione s-transferase)
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1c72d1, d1c72d2
  • Heterogens: EPY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c72A (A:)
    vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp
    ylidgdvkltqsnailryiarkhnmcgetevekqrvdvlenhlmdlrmafarlcyspdfe
    klkpaylellpgklrqlsrflgsrswfvgdkltfvdflaydvldqqrmfvpdcpelqgnl
    sqflqrfealekisaymrsgrfmkapifwytalwnnkke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c72A (A:)
    vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp
    ylidgdvkltqsnailryiarkhnmcgetevekqrvdvlenhlmdlrmafarlcyspdfe
    klkpaylellpgklrqlsrflgsrswfvgdkltfvdflaydvldqqrmfvpdcpelqgnl
    sqflqrfealekisaymrsgrfmkapifwytalwnnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c72B (B:)
    vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp
    ylidgdvkltqsnailryiarkhnmcgetevekqrvdvlenhlmdlrmafarlcyspdfe
    klkpaylellpgklrqlsrflgsrswfvgdkltfvdflaydvldqqrmfvpdcpelqgnl
    sqflqrfealekisaymrsgrfmkapifwytalwnnkke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c72B (B:)
    vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp
    ylidgdvkltqsnailryiarkhnmcgetevekqrvdvlenhlmdlrmafarlcyspdfe
    klkpaylellpgklrqlsrflgsrswfvgdkltfvdflaydvldqqrmfvpdcpelqgnl
    sqflqrfealekisaymrsgrfmkapifwytalwnnk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1c72C (C:)
    vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp
    ylidgdvkltqsnailryiarkhnmcgetevekqrvdvlenhlmdlrmafarlcyspdfe
    klkpaylellpgklrqlsrflgsrswfvgdkltfvdflaydvldqqrmfvpdcpelqgnl
    sqflqrfealekisaymrsgrfmkapifwytalwnnkke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c72C (C:)
    vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp
    ylidgdvkltqsnailryiarkhnmcgetevekqrvdvlenhlmdlrmafarlcyspdfe
    klkpaylellpgklrqlsrflgsrswfvgdkltfvdflaydvldqqrmfvpdcpelqgnl
    sqflqrfealekisaymrsgrfmkapifwytalwnnk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1c72D (D:)
    vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp
    ylidgdvkltqsnailryiarkhnmcgetevekqrvdvlenhlmdlrmafarlcyspdfe
    klkpaylellpgklrqlsrflgsrswfvgdkltfvdflaydvldqqrmfvpdcpelqgnl
    sqflqrfealekisaymrsgrfmkapifwytalwnnkke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c72D (D:)
    vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp
    ylidgdvkltqsnailryiarkhnmcgetevekqrvdvlenhlmdlrmafarlcyspdfe
    klkpaylellpgklrqlsrflgsrswfvgdkltfvdflaydvldqqrmfvpdcpelqgnl
    sqflqrfealekisaymrsgrfmkapifwytalwnnk