PDB entry 1c6z

View 1c6z on RCSB PDB site
Description: alternate binding site for the p1-p3 group of a class of potent hiv-1 protease inhibitors as a result of concerted structural change in 80's loop.
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase-hydrolase inhibitor complex
Deposited on 1999-12-28, released 2000-12-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.18
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (protease)
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: NY5 ISOLATE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1c6za_
  • Chain 'B':
    Compound: protein (protease)
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: NY5 ISOLATE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1c6zb_
  • Heterogens: ROC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c6zA (A:)
    pqitlwqrpvvtikiggqlmealidtgaddtvleemdlpgrwkpkiiggiggfvkvrqyd
    qipieicghkvigtvlvgptptniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c6zB (B:)
    pqitlwqrpvvtikiggqlmealidtgaddtvleemdlpgrwkpkiiggiggfvkvrqyd
    qipieicghkvigtvlvgptptniigrnlltqigctlnf