PDB entry 1c6y

View 1c6y on RCSB PDB site
Description: alternate binding site for the p1-p3 group of a class of potent hiv-1 protease inhibitors as a result of concerted structural change in 80's loop.
Deposited on 1999-12-28, released 2000-12-28
The last revision prior to the SCOP 1.63 freeze date was dated 2000-12-28, with a file datestamp of 2000-12-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.18
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1c6ya_
  • Chain 'B':
    Domains in SCOP 1.63: d1c6yb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c6yA (A:)
pqitlwqrpvvtikiggqlmealidtgaddtvleemdlpgrwkpkiiggiggfvkvrqyd
qipieicghkvigtvlvgptptniigrnlltqigctlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c6yB (B:)
pqitlwqrpvvtikiggqlmealidtgaddtvleemdlpgrwkpkiiggiggfvkvrqyd
qipieicghkvigtvlvgptptniigrnlltqigctlnf