PDB entry 1c6x

View 1c6x on RCSB PDB site
Description: alternate binding site for the p1-p3 group of a class of potent hiv-1 protease inhibitors as a result of concerted structural change in 80's loop.
Class: hydrolase
Keywords: hydrolase
Deposited on 1999-12-28, released 2000-12-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (protease)
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: NY5 ISOLATE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1c6xa_
  • Chain 'B':
    Compound: protein (protease)
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: NY5 ISOLATE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1c6xb_
  • Heterogens: 3IN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c6xA (A:)
    pqitlwqrpvvtikiggqlmealidtgaddtvleemdlpgrwkpkiiggiggfvkvrqyd
    qipieicghkvigtvlvgptptniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c6xB (B:)
    pqitlwqrpvvtikiggqlmealidtgaddtvleemdlpgrwkpkiiggiggfvkvrqyd
    qipieicghkvigtvlvgptptniigrnlltqigctlnf