PDB entry 1c6v

View 1c6v on RCSB PDB site
Description: siv integrase (catalytic domain + dna biding domain comprising residues 50-293) mutant with phe 185 replaced by his (f185h)
Deposited on 1999-12-21, released 2000-12-27
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-27, with a file datestamp of 2000-12-27.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.203
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1c6va_
  • Chain 'B':
    Domains in SCOP 1.55: d1c6vb_
  • Chain 'C':
    Domains in SCOP 1.55: d1c6vc_
  • Chain 'D':
    Domains in SCOP 1.55: d1c6vd_
  • Chain 'X':
    Domains in SCOP 1.55: d1c6vx_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c6vA (A:)
    nsdlgtwqmdcthlegkivivavhvasgfieaevipqetgrqtalfllklagrwpithlh
    tdnganfasqevkmvawwagiehtfgvpynpqsqgvveamnhhlknqidrireqansvet
    ivlmavhcmnhkrrggigdmtpaerlinmitteqeiqfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c6vA (A:)
    nsdlgtwqmdcthlegkivivavhvasgfieaevipqetgrqtalfllklagrwpithlh
    tdnganfasqevkmvawwagiehtfgeamnhhlknqidrireqansvetivlmavhcmnh
    krrggigdmtpaerlinmitteqeiqfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c6vB (B:)
    nsdlgtwqmdcthlegkivivavhvasgfieaevipqetgrqtalfllklagrwpithlh
    tdnganfasqevkmvawwagiehtfgvpynpqsqgvveamnhhlknqidrireqansvet
    ivlmavhcmnhkrrggigdmtpaerlinmitte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c6vB (B:)
    nsdlgtwqmdcthlegkivivavhvasgfieaevipqetgrqtalfllklagrwpithlh
    tdnganfasqevkmvawwagiehtfgeamnhhlknqidrireqansvetivlmavhcmnh
    krrggigdmtpaerlinmitte
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1c6vC (C:)
    nsdlgtwqmdcthlegkivivavhvasgfieaevipqetgrqtalfllklagrwpithlh
    tdnganfasqevkmvawwagiehtfgvpynpqsqgvveamnhhlknqidrireqansvet
    ivlmavhcmnhkrrggigdmtpaerlinmitte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c6vC (C:)
    nsdlgtwqmdcthlegkivivavhvasgfieaevipqetgrqtalfllklagrwpithlh
    tdnganfasqevkmvawwagiehtfgveamnhhlknqidrireqansvetivlmavhcmn
    hkrrggigdmtpaerlinmitte
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1c6vD (D:)
    nsdlgtwqmdcthlegkivivavhvasgfieaevipqetgrqtalfllklagrwpithlh
    tdnganfasqevkmvawwagiehtfgvpynpqsqgvveamnhhlknqidrireqansvet
    ivlmavhcmnhkrrggigdmtpaerlinmitte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c6vD (D:)
    nsdlgtwqmdcthlegkivivavhvasgfieaevipqetgrqtalfllklagrwpithlh
    tdnganfasqevkmvawwagiehtfgeamnhhlknqidrireqansvetivlmavhcmnh
    krrggigdmtpaerlinmitte
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c6vX (X:)
    knskfknfrvyyregrdqlwkgpgellwkgegavllkvgtdikvvprrkakiikd