PDB entry 1c6v

View 1c6v on RCSB PDB site
Description: siv integrase (catalytic domain + DNA biding domain comprising residues 50-293) mutant with phe 185 replaced by his (f185h)
Class: DNA binding protein
Keywords: DNA integration, DNA binding protein
Deposited on 1999-12-21, released 2000-12-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (siv integrase)
    Species: Simian immunodeficiency virus [TaxId:11723]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88016 (Start-163)
      • engineered mutation (135)
    Domains in SCOPe 2.08: d1c6va_
  • Chain 'B':
    Compound: protein (siv integrase)
    Species: Simian immunodeficiency virus [TaxId:11723]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88016
      • engineered mutation (135)
    Domains in SCOPe 2.08: d1c6vb_
  • Chain 'C':
    Compound: protein (siv integrase)
    Species: Simian immunodeficiency virus [TaxId:11723]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88016
      • engineered mutation (135)
    Domains in SCOPe 2.08: d1c6vc_
  • Chain 'D':
    Compound: protein (siv integrase)
    Species: Simian immunodeficiency virus [TaxId:11723]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88016
      • engineered mutation (135)
    Domains in SCOPe 2.08: d1c6vd_
  • Chain 'X':
    Compound: protein (siu89134)
    Species: Simian immunodeficiency virus [TaxId:11723]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87706
      • conflict (37)
    Domains in SCOPe 2.08: d1c6vx_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c6vA (A:)
    ihgqvnsdlgtwqmdcthlegkivivavhvasgfieaevipqetgrqtalfllklagrwp
    ithlhtdnganfasqevkmvawwagiehtfgvpynpqsqgvveamnhhlknqidrireqa
    nsvetivlmavhcmnhkrrggigdmtpaerlinmitteqeiqfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c6vA (A:)
    nsdlgtwqmdcthlegkivivavhvasgfieaevipqetgrqtalfllklagrwpithlh
    tdnganfasqevkmvawwagiehtfgeamnhhlknqidrireqansvetivlmavhcmnh
    krrggigdmtpaerlinmitteqeiqfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c6vB (B:)
    ihgqvnsdlgtwqmdcthlegkivivavhvasgfieaevipqetgrqtalfllklagrwp
    ithlhtdnganfasqevkmvawwagiehtfgvpynpqsqgvveamnhhlknqidrireqa
    nsvetivlmavhcmnhkrrggigdmtpaerlinmitteqeiqfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c6vB (B:)
    nsdlgtwqmdcthlegkivivavhvasgfieaevipqetgrqtalfllklagrwpithlh
    tdnganfasqevkmvawwagiehtfgeamnhhlknqidrireqansvetivlmavhcmnh
    krrggigdmtpaerlinmitte
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1c6vC (C:)
    ihgqvnsdlgtwqmdcthlegkivivavhvasgfieaevipqetgrqtalfllklagrwp
    ithlhtdnganfasqevkmvawwagiehtfgvpynpqsqgvveamnhhlknqidrireqa
    nsvetivlmavhcmnhkrrggigdmtpaerlinmitteqeiqfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c6vC (C:)
    nsdlgtwqmdcthlegkivivavhvasgfieaevipqetgrqtalfllklagrwpithlh
    tdnganfasqevkmvawwagiehtfgveamnhhlknqidrireqansvetivlmavhcmn
    hkrrggigdmtpaerlinmitte
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1c6vD (D:)
    ihgqvnsdlgtwqmdcthlegkivivavhvasgfieaevipqetgrqtalfllklagrwp
    ithlhtdnganfasqevkmvawwagiehtfgvpynpqsqgvveamnhhlknqidrireqa
    nsvetivlmavhcmnhkrrggigdmtpaerlinmitteqeiqfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c6vD (D:)
    nsdlgtwqmdcthlegkivivavhvasgfieaevipqetgrqtalfllklagrwpithlh
    tdnganfasqevkmvawwagiehtfgeamnhhlknqidrireqansvetivlmavhcmnh
    krrggigdmtpaerlinmitte
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1c6vX (X:)
    qqsknskfknfrvyyregrdqlwkgpgellwkgegavllkvgtdikvvprrkakiikdyg
    ggkevdssshmedtgeareva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c6vX (X:)
    knskfknfrvyyregrdqlwkgpgellwkgegavllkvgtdikvvprrkakiikd