PDB entry 1c6b

View 1c6b on RCSB PDB site
Description: t4 lysozyme mutant c54t/c97a/l133a in the presence of 8 atm xenon
Deposited on 1999-12-21, released 2000-10-04
The last revision prior to the SCOP 1.55 freeze date was dated 2000-10-04, with a file datestamp of 2000-10-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.166
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1c6ba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c6bA (A:)
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
lqqkrwdeaavnaaksrwynqtpnrakrvittfrtgtwdayk