PDB entry 1c69

View 1c69 on RCSB PDB site
Description: t4 lysozyme mutant c54t/c97a/l133a in the presence of 8 atm argon
Deposited on 1999-12-21, released 2000-10-04
The last revision prior to the SCOP 1.55 freeze date was dated 2000-10-04, with a file datestamp of 2000-10-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.165
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1c69a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c69A (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnaaksrwynqtpnrakrvittfrtgtwdayk