PDB entry 1c5y

View 1c5y on RCSB PDB site
Description: structural basis for selectivity of a small molecule, s1-binding, sub-micromolar inhibitor of urokinase type plasminogen activator
Class: blood clotting
Keywords: selective, S1 site inhibitor, structure-based drug design, urokinase, trypsin, thrombin, BLOOD CLOTTING
Deposited on 1999-12-22, released 2000-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (urokinase-type plasminogen activator)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c5y.1
  • Chain 'B':
    Compound: protein (urokinase-type plasminogen activator)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00749 (0-End)
      • conflict (143)
    Domains in SCOPe 2.07: d1c5y.1
  • Heterogens: FLC, ESP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c5yA (A:)
    kpssppeelkfqcgqktlrprfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c5yA (A:)
    lkfqcgqkt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c5yB (B:)
    iiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfidypkkedyivy
    lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
    clpsmyndpqfgtsceitgfgkeastdylypeqlkmtvvklishrecqqphyygsevttk
    mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
    irshtkeenglal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c5yB (B:)
    iiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfidypkkedyivy
    lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
    clpsmyndpqfgtsceitgfgkeastdylypeqlkmtvvklishrecqqphyygsevttk
    mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
    irshtkee