PDB entry 1c5t

View 1c5t on RCSB PDB site
Description: structural basis for selectivity of a small molecule, s1-binding, sub-micromolar inhibitor of urokinase type plasminogen activator
Class: hydrolase
Keywords: selective, S1 site inhibitor, structure-based drug design, urokinase, trypsin, thrombin
Deposited on 1999-12-22, released 2000-12-22
The last revision prior to the SCOP 1.75 freeze date was dated 2001-09-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: 0.176
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (trypsin)
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1c5ta_
  • Heterogens: CA, ESP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c5tA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn