PDB entry 1c5r

View 1c5r on RCSB PDB site
Description: structural basis for selectivity of a small molecule, s1-binding, sub- micromolar inhibitor of urokinase type plasminogen activator
Deposited on 1999-12-22, released 2000-12-22
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-22, with a file datestamp of 2000-12-22.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.192
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1c5ra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5rA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn