PDB entry 1c5k

View 1c5k on RCSB PDB site
Description: the structure of tolb, an essential component of the tol-dependent translocation system and its interactions with the translocation domain of colicin e9
Deposited on 1999-12-05, released 2000-12-06
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-06, with a file datestamp of 2000-12-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.234
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5kA (A:)
    grpigvvpfqwagpgaapediggivaadlrnsgkfnpldrarlpqqpgsaqevqpaawsa
    lgidavvvgqvtpnpdgsynvayqlvdtggapgtvlaqnsykvnkqwlryaghtasdevf
    ekltgikgafrtriayvvqtnggqfpyelrvsdydgynqfvvhrspqplmspawspdgsk
    layvtfesgrsalviqtlangavrqvasfprhngapafspdgsklafalsktgslnlyvm
    dlasgqirqvtdgrsnnteptwfpdsqnlaftsdqagrpqvykvninggapqritwegsq
    nqdadvssdgkfmvmvssnggqqhiakqdlatggvqvlsstfldetpslapngtmviyss
    sqgmgsvlnlvstdgrfkarlpatdgqvkfpawspyl