PDB entry 1c5i

View 1c5i on RCSB PDB site
Description: hydrogen bonding and catalysis: an unexpected explanation for how a single amino acid substitution can change the ph optimum of a glycosidase
Class: hydrolase
Keywords: glycosidase, ph-dependent enzyme mechanism, general acid/ base catalysis, nmr, x-ray crystallography, isotope shift, short hydrogen bonds, xylan, hydrolase
Deposited on 1999-11-24, released 2000-05-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: Bacillus circulans [TaxId:1397]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09850 (0-184)
      • engineered (34)
    Domains in SCOPe 2.01: d1c5ia_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5iA (A:)
    astdywqnwtdgggivnavngsggnysvnwsntgdfvvgkgwttgspfrtinynagvwap
    ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
    drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
    nvtvw