PDB entry 1c5i

View 1c5i on RCSB PDB site
Description: hydrogen bonding and catalysis: an unexpected explanation for how a single amino acid substitution can change the ph optimum of a glycosidase
Class: hydrolase
Keywords: glycosidase, ph-dependent enzyme mechanism, general acid/ base catalysis, nmr, x-ray crystallography, isotope shift, short hydrogen bonds, xylan
Deposited on 1999-11-24, released 2000-05-12
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: endo-1,4-beta-xylanase
  Species: Bacillus circulans
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09850 (0-184)
    • engineered (34)
  Domains in SCOP 1.73: d1c5ia_
• Heterogens: XYP, DFX, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c5iA (A:)
  astdywqnwtdgggivnavngsggnysvnwsntgdfvvgkgwttgspfrtinynagvwap
  ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
  drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
  nvtvw