PDB entry 1c5h

View 1c5h on RCSB PDB site
Description: hydrogen bonding and catalysis: an unexpected explanation for how a single amino acid substitution can change the ph optimum of a glycosidase
Class: hydrolase
Keywords: glycosidase, ph-dependent enzyme mechanism, general acid/ base catalysis, nmr, x-ray cyrstallography, isotope shift, short hydrogen bonds, xylan, hydrolase
Deposited on 1999-11-24, released 2000-05-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.194
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: endo-1,4-beta-xylanase
  Species: Bacillus circulans [TaxId:1397]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09850 (0-184)
    • engineered (34)
  Domains in SCOPe 2.08: d1c5ha_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c5hA (A:)
  astdywqnwtdgggivnavngsggnysvnwsntgdfvvgkgwttgspfrtinynagvwap
  ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
  drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
  nvtvw