PDB entry 1c5f

View 1c5f on RCSB PDB site
Description: crystal structure of the cyclophilin-like domain from brugia malayi complexed with cyclosporin a
Deposited on 1999-11-22, released 1999-12-02
The last revision prior to the SCOP 1.57 freeze date was dated 2000-04-07, with a file datestamp of 2000-04-07.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: 0.201
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1c5fa_
  • Chain 'C':
    Domains in SCOP 1.57: d1c5fc_
  • Chain 'E':
    Domains in SCOP 1.57: d1c5fe_
  • Chain 'G':
    Domains in SCOP 1.57: d1c5fg_
  • Chain 'I':
    Domains in SCOP 1.57: d1c5fi_
  • Chain 'K':
    Domains in SCOP 1.57: d1c5fk_
  • Chain 'M':
    Domains in SCOP 1.57: d1c5fm_
  • Chain 'O':
    Domains in SCOP 1.57: d1c5fo_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5fA (A:)
    mskkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhyk
    gstfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntng
    sqffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5fC (C:)
    mskkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhyk
    gstfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntng
    sqffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5fE (E:)
    kdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgst
    fhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsqf
    fitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5fG (G:)
    rrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgstfh
    rviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsqffi
    tttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5fI (I:)
    drrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgstf
    hrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsqff
    itttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5fK (K:)
    kkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgs
    tfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsq
    ffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5fM (M:)
    kkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgs
    tfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsq
    ffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5fO (O:)
    rrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgstfh
    rviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsqffi
    tttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv