PDB entry 1c5f

View 1c5f on RCSB PDB site
Description: crystal structure of the cyclophilin-like domain from brugia malayi complexed with cyclosporin a
Class: isomerase/immunosuppressant
Keywords: isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, cyclosporin a, immunosuppressant, cyclophilin
Deposited on 1999-11-22, released 1999-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-prolyl cis-trans isomerase 1
    Species: Brugia malayi [TaxId:6279]
    Gene: BMCYP-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c5fa_
  • Chain 'B':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'C':
    Compound: peptidyl-prolyl cis-trans isomerase 1
    Species: Brugia malayi [TaxId:6279]
    Gene: BMCYP-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c5fc_
  • Chain 'D':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'E':
    Compound: peptidyl-prolyl cis-trans isomerase 1
    Species: Brugia malayi [TaxId:6279]
    Gene: BMCYP-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c5fe_
  • Chain 'F':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'G':
    Compound: peptidyl-prolyl cis-trans isomerase 1
    Species: Brugia malayi [TaxId:6279]
    Gene: BMCYP-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c5fg_
  • Chain 'H':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'I':
    Compound: peptidyl-prolyl cis-trans isomerase 1
    Species: Brugia malayi [TaxId:6279]
    Gene: BMCYP-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c5fi_
  • Chain 'J':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'K':
    Compound: peptidyl-prolyl cis-trans isomerase 1
    Species: Brugia malayi [TaxId:6279]
    Gene: BMCYP-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c5fk_
  • Chain 'L':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'M':
    Compound: peptidyl-prolyl cis-trans isomerase 1
    Species: Brugia malayi [TaxId:6279]
    Gene: BMCYP-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c5fm_
  • Chain 'N':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'O':
    Compound: peptidyl-prolyl cis-trans isomerase 1
    Species: Brugia malayi [TaxId:6279]
    Gene: BMCYP-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c5fo_
  • Chain 'P':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5fA (A:)
    mskkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhyk
    gstfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntng
    sqffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5fC (C:)
    mskkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhyk
    gstfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntng
    sqffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1c5fE (E:)
    mskkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhyk
    gstfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntng
    sqffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c5fE (E:)
    kdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgst
    fhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsqf
    fitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1c5fG (G:)
    mskkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhyk
    gstfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntng
    sqffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c5fG (G:)
    rrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgstfh
    rviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsqffi
    tttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1c5fI (I:)
    mskkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhyk
    gstfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntng
    sqffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c5fI (I:)
    drrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgstf
    hrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsqff
    itttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1c5fK (K:)
    mskkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhyk
    gstfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntng
    sqffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c5fK (K:)
    kkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgs
    tfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsq
    ffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1c5fM (M:)
    mskkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhyk
    gstfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntng
    sqffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c5fM (M:)
    kkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgs
    tfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsq
    ffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv
    

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1c5fO (O:)
    mskkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhyk
    gstfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntng
    sqffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c5fO (O:)
    rrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhykgstfh
    rviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntngsqffi
    tttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv
    

  • Chain 'P':
    No sequence available.