PDB entry 1c5c

View 1c5c on RCSB PDB site
Description: decarboxylase catalytic antibody 21d8-hapten complex
Class: immune system
Keywords: immunoglobulin, catalytic antibody, chimeric fab, decarboxylase, hapten complex
Deposited on 1999-11-09, released 2000-10-11
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.188
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: chimeric decarboxylase antibody 21d8
    Species: MUS MUSCULUS + HOMO SAPIENS
    Domains in SCOP 1.73: d1c5ch1, d1c5ch2
  • Chain 'L':
    Compound: chimeric decarboxylase antibody 21d8
    Species: MUS MUSCULUS + HOMO SAPIENS
    Domains in SCOP 1.73: d1c5cl1, d1c5cl2
  • Heterogens: TK4, GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5cH (H:)
    qvqllepgtelvkpgasvklscrasgysftsywmhwvkqrpgqglewiglidpsngrtnf
    ndkfksratltvdtssstaymqlssltsedsavyycvriaywgqgtlvtvssastkgpsv
    fplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
    vtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5cL (L:)
    eiqltqspsslsaslgervsltcrtsqeisgylswlqqkpdgtikrliydatkldsgapk
    rfsgsrsgsdysltisslesedfadyyclqyasfprtfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec