PDB entry 1c5c

View 1c5c on RCSB PDB site
Description:
Deposited on 1999-11-09, released 2000-10-11
The last revision prior to the SCOP 1.69 freeze date was dated 2000-10-11, with a file datestamp of 2000-10-11.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.188
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1c5ch1, d1c5ch2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1c5cl1, d1c5cl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5cH (H:)
    qvqllepgtelvkpgasvklscrasgysftsywmhwvkqrpgqglewiglidpsngrtnf
    ndkfksratltvdtssstaymqlssltsedsavyycvriaywgqgtlvtvssastkgpsv
    fplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
    vtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5cL (L:)
    eiqltqspsslsaslgervsltcrtsqeisgylswlqqkpdgtikrliydatkldsgapk
    rfsgsrsgsdysltisslesedfadyyclqyasfprtfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec