PDB entry 1c5b

View 1c5b on RCSB PDB site
Description: decarboxylase catalytic antibody 21d8 unliganded form
Class: immune system
Keywords: immunoglobulin, catalytic antibody, chimeric fab, decarboxylase, unliganded
Deposited on 1999-11-08, released 2000-10-11
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.188
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: chimeric decarboxylase antibody 21d8
    Species: MUS MUSCULUS + HOMO SAPIENS
    Domains in SCOP 1.73: d1c5bh1, d1c5bh2
  • Chain 'L':
    Compound: chimeric decarboxylase antibody 21d8
    Species: MUS MUSCULUS + HOMO SAPIENS
    Domains in SCOP 1.73: d1c5bl1, d1c5bl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5bH (H:)
    qvqllepgtelvkpgasvklscrasgysftsywmhwvkqrpgqglewiglidpsngrtnf
    ndkfksratltvdtssstaymqlssltsedsavyycvriaywgqgtlvtvssastkgpsv
    fplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
    vtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c5bL (L:)
    eiqltqspsslsaslgervsltcrtsqeisgylswlqqkpdgtikrliydatkldsgapk
    rfsgsrsgsdysltisslesedfadyyclqyasfprtfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec