PDB entry 1c5a

View 1c5a on RCSB PDB site
Description: three-dimensional structure of porcine c5ades*arg from 1h nuclear magnetic resonance data
Class: complement factor
Keywords: complement factor
Deposited on 1990-06-12, released 1991-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: complement c5a anaphylatoxin
    Species: Sus scrofa domestica [TaxId:9825]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c5aa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c5aA (A:)
    mlqkkieeeaakykyamlkkccydgayrnddetceeraarikigpkcvkafkdccyianq
    vraeqshkniqlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c5aA (A:)
    mlqkkieeeaakykyamlkkccydgayrnddetceeraarikigpkcvkafkdccyianq
    vraeqs