PDB entry 1c57

View 1c57 on RCSB PDB site
Description: direct determination of the positions of deuterium atoms of bound water in concanavalin a by neutron laue crystallography
Class: sugar binding protein
Keywords: concanavalin a, neutron laue diffraction, bound d2o molecules
Deposited on 1999-10-26, released 2000-05-08
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NEUT
Resolution: 2.4 Å
R-factor: 0.27
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (concanavalin a)
  Species: Canavalia ensiformis
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02866 (118-236)
    • see remark 999 (150)
    • see remark 999 (154)
  Domains in SCOP 1.75: d1c57a_
• Heterogens: MN, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c57A (A:)
  adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
  lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
  hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
  iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan