PDB entry 1c57

View 1c57 on RCSB PDB site
Description: direct determination of the positions of deuterium atoms of bound water in concanavalin a by neutron laue crystallography
Class: sugar binding protein
Keywords: concanavalin a, neutron laue diffraction, bound d2o molecules, sugar binding protein
Deposited on 1999-10-26, released 2000-05-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: NEUT
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Concanavalin-Br
  Species: Canavalia ensiformis [TaxId:3823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P55915 (0-236)
    • conflict (57)
    • conflict (69)
    • conflict (150)
    • conflict (154)
  Domains in SCOPe 2.08: d1c57a_
• Heterogens: MN, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c57A (A:)
  adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
  lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
  hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
  iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan