PDB entry 1c55

View 1c55 on RCSB PDB site
Description: nmr solution structure of butantoxin
Deposited on 1999-10-19, released 2000-07-19
The last revision prior to the SCOP 1.57 freeze date was dated 2000-07-19, with a file datestamp of 2000-07-19.
Experiment type: NMR35
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1c55a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c55A (A:)
    wcstcldlacgasrecydpcfkafgrahgkcmnnkcrcyt