PDB entry 1c55

View 1c55 on RCSB PDB site
Description: nmr solution structure of butantoxin
Class: toxin
Keywords: butantoxin, nmr structure
Deposited on 1999-10-19, released 2000-07-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: butantoxin
  Species: Tityus serrulatus [TaxId:6887]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59936 (0-39)
  Domains in SCOPe 2.08: d1c55a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c55A (A:)
  wcstcldlacgasrecydpcfkafgrahgkcmnnkcrcyt