PDB entry 1c54

View 1c54 on RCSB PDB site
Description: solution structure of ribonuclease sa
Class: hydrolase
Keywords: alpha+beta protein
Deposited on 1999-10-22, released 2001-11-28
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease sa
  Species: Streptomyces aureofaciens
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05798 (0-95)
    • see remark 999 (71)
  Domains in SCOP 1.75: d1c54a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c54A (A:)
  dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
  gartrgtrriitgeatqedyytgdhyatfslidqtc