PDB entry 1c54

View 1c54 on RCSB PDB site
Description: solution structure of ribonuclease sa
Class: hydrolase
Keywords: alpha+beta protein, hydrolase
Deposited on 1999-10-22, released 2001-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease sa
    Species: Streptomyces aureofaciens [TaxId:1894]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05798 (0-95)
      • see remark 999 (71)
    Domains in SCOPe 2.07: d1c54a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c54A (A:)
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc