PDB entry 1c53

View 1c53 on RCSB PDB site
Description: s-class cytochromes c have a variety of folding patterns: structure of cytochrome c-553 from desulfovibrio vulgaris determined by the multi-wavelength anomalous dispersion method
Class: electron transport
Keywords: electron transport
Deposited on 1991-08-26, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c553
    Species: Desulfovibrio vulgaris str. 'Miyazaki F' [TaxId:883]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1c53a_
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c53A (A:)
    adgaalykscvgchgadgskqamgvghavkgqkadelfkklkgyadgsyggekkavmtnl
    vkrysdeemkamadymskl