PDB entry 1c52

View 1c52 on RCSB PDB site
Description: thermus thermophilus cytochrome-c552: a new highly thermostable cytochrome-c structure obtained by mad phasing
Class: electron transport protein
Keywords: electron transport protein, cytochrome-c552, mad, thermostability
Deposited on 1997-06-23, released 1998-06-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: 0.191
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome-c552
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04164 (0-130)
  Domains in SCOPe 2.08: d1c52a_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c52A (A:)
  qadgakiyaqcagchqqngqgipgafpplaghvaeilakeggreylilvllyglqgqiev
  kgmkyngvmssfaqlkdeeiaavlnhiatawgdakkvkgfkpftaeevkklrakkltpqq
  vlaerkklglk